Predicate | Object |
---|---|
rdf:type | |
biopax3:comment |
FUNCTION: GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP- ribosyltransferase. Involved in protein trafficking among different compartments. Modulates vesicle budding and uncoating within the Golgi complex. Deactivation induces the redistribution of the entire Golgi complex to the endoplasmic reticulum, suggesting a crucial role in protein trafficking. In its GTP-bound form, its triggers the association with coat proteins with the Golgi membrane. The hydrolysis of ARF1-bound GTP, which is mediated by ARFGAPs proteins, is required for dissociation of coat proteins from Golgi membranes and vesicles. SUBUNIT: Interacts with PRKCABP, GGA1, ASAP2 and PIP5K1B (By similarity). Interacts with ARFGAP1, which hydrolyzes GTP and thus, regulates its function. Binds ASAP2. Interacts with HERC1 and ARHGAP21. Interacts with PI4KB in the Golgi complex. Interacts with NCS1/FREQ in the Golgi and at the plasma membrane. This interaction at the plasm membrane requires a myristoylated NCS1/FREQ. Interacts with TMED2 and TMED10. Interacts with PLEKHA3. SUBCELLULAR LOCATION: Golgi apparatus. Cytoplasm, perinuclear region. SIMILARITY: Belongs to the small GTPase superfamily. Arf family. GENE SYNONYMS:ARF1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 181 AA; 20697 MW; AAC773D4A60186B6 CRC64;
|
biopax3:xref |
urn:biopax:RelationshipXref:HGNC_HGNC:652,
urn:biopax:RelationshipXref:NCBI GENE_375,
urn:biopax:RelationshipXref:REFSEQ_NP_001019397,
urn:biopax:RelationshipXref:REFSEQ_NP_001019398,
urn:biopax:RelationshipXref:REFSEQ_NP_001019399,
urn:biopax:RelationshipXref:REFSEQ_NP_001649,
urn:biopax:UnificationXref:UNIPROT_P10947,
urn:biopax:UnificationXref:UNIPROT_P32889,
urn:biopax:UnificationXref:UNIPROT_P84077
|
biopax3:displayName |
ARF1_HUMAN
|
biopax3:name |
ARF1
|
biopax3:entityFeature | |
biopax3:organism | |
biopax3:sequence |
MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
|
biopax3:standardName |
ADP-ribosylation factor 1
|