| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: May negatively regulate aerobic respiration through mitochondrial protein lysine-acetylation. May counteract the action of the deacetylase SIRT3 by acetylating and regulating proteins of the mitochondrial respiratory chain including ATP5A1 AND NDUFA9. May also be involved in the biogenesis of specialized organelles of the endosomal-lysosomal system. SUBUNIT: Part of the biogenesis of lysosome-related organelles complex 1 (BLOC-1) that is required for normal biogenesis of lysosome-related organelles, such as platelet dense granules and melanosomes and is composed of BLOC1S1, BLOC1S2, BLOC1S3, DTNBP1, MUTED, PLDN, CNO/cappuccino and SNAPIN. Interacts with ATP5A1 and NDUFA9; involved in their acetylation on lysine residues. SUBCELLULAR LOCATION: Mitochondrion intermembrane space. Mitochondrion matrix. Cytoplasm, cytosol. ALTERNATIVE PRODUCTS: Event=Alternative initiation; Named isoforms=2; Name=1; IsoId=P78537-1; Sequence=Displayed; Name=2; IsoId=P78537-2; Sequence=VSP_040954; Note=May be produced by alternative initiation at Met-27 of isoform 1. A polymorphism at position 9 leads to the creation of a stop codon. Isoform 2 is the the only form that exists in orthologs (except primates); SIMILARITY: Belongs to the BLOC1S1 family. SEQUENCE CAUTION: Sequence=AAB37682.1; Type=Erroneous initiation; Note=Translation N-terminally extended; GENE SYNONYMS:BLOC1S1 BLOS1 GCN5L1 RT14. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 153 AA; 17263 MW; B7D1FE64F242B25A CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
BL1S1_HUMAN
|
| biopax3:name |
BLOC-1 subunit 1,
BLOC1S1,
GCN5-like protein 1,
Protein RT14
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MAPGSRGERSSFRSRRGPGVPSPQPDVTMLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS
|
| biopax3:standardName |
Biogenesis of lysosome-related organelles complex 1 subunit 1
|