Linked Life Data

P78380

Source:http://identifiers.org/uniprot/P78380

Statements in which the resource exists as a subject.
PredicateObject
rdf:type
biopax3:comment
FUNCTION: Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro- oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro- atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram- positive bacteria. SUBUNIT: Homodimer; disulfide-linked. May form a hexamer composed of 3 homodimers. Interacts with HSP70. SUBCELLULAR LOCATION: Cell membrane; Single-pass type II membrane protein. Secreted. Note=A secreted form also exists. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P78380-1; Sequence=Displayed; Name=2; IsoId=P78380-2; Sequence=VSP_042555; Note=No experimental confirmation available; TISSUE SPECIFICITY: Expressed at high level in endothelial cells and vascular-rich organs such as placenta, lung, liver and brain, aortic intima, bone marrow, spinal cord and substantia nigra. Also expressed at the surface of dendritic cells. Widely expressed at intermediate and low level. INDUCTION: By inflammatory cytokines such as TNF, IFNG/IFN-gamma, IL6/interleukin-6 and by pathological conditions such as hyperlipidemia, hypertension and diabetes mellitus. Up-regulated in atherosclerotic lesions, by oxLDL, reactive oxygen species and fluid shear stress, suggesting that it may participate in amplification of oxLDL-induced vascular dysfunction. DOMAIN: The cytoplasmic region is required for subcellular sorting on the cell surface. DOMAIN: The C-type lectin domain mediates the recognition and binding of oxLDL. PTM: The intrachain disulfide-bonds prevent N-glycosylation at some sites. PTM: N-glycosylated. DISEASE: Note=Independent association genetic studies have implicated OLR1 gene variants in myocardial infarction susceptibility. DISEASE: Note=OLR1 may be involved in Alzheimer disease (AD). Involvement in AD is however unclear: according to some authors (PubMed:12354387, PubMed:12810610 and PubMed:15976314), variations in OLR1 modify the risk of AD, while according to other (PubMed:15000751 and PubMed:15060104) they do not. SIMILARITY: Contains 1 C-type lectin domain. WEB RESOURCE: Name=Functional Glycomics Gateway - Glycan Binding; Note=Oxidized LDL receptor; URL="http://www.functionalglycomics.org/glycomics/GBPServlet?&operationType=view&cbpId=cbp_hum_Ctlect_249"; GENE SYNONYMS:OLR1 CLEC8A LOX1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 273 AA; 30959 MW; 852DE6595DC3D361 CRC64;
biopax3:xref
biopax3:displayName
OLR1_HUMAN
biopax3:name
C-type lectin domain family 8 member A, LOX-1, Lectin-like oxLDL receptor 1, Lectin-like oxidized LDL receptor 1, Lectin-type oxidized LDL receptor 1, OLR1, Ox-LDL receptor 1, Oxidized low-density lipoprotein receptor 1, soluble form, hLOX-1
biopax3:organism
biopax3:sequence
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
biopax3:standardName
Oxidized low-density lipoprotein receptor 1