Predicate | Object |
---|---|
rdf:type | |
biopax3:comment |
FUNCTION: Regulates eIF4E activity by preventing its assembly into the eIF4F complex. Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase pathway (By similarity). SUBUNIT: Nonphosphorylated EIF4EBP2 interacts with EIF4E (By similarity). PTM: Phosphorylated on serine and threonine residues in response to insulin, EGF and PDGF (By similarity). SIMILARITY: Belongs to the eIF4E-binding protein family. GENE SYNONYMS:Eif4ebp2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 120 AA; 12898 MW; 0A1ACC082583F769 CRC64;
|
biopax3:xref | |
biopax3:displayName |
4EBP2_MOUSE
|
biopax3:name |
4E-BP2,
Eif4ebp2,
PHAS-II,
Phosphorylated heat- and acid-stable protein regulated by insulin 2,
eIF4E-binding protein 2
|
biopax3:entityFeature | |
biopax3:organism | |
biopax3:sequence |
MSASAGGSHQPSQSRAIPTRTVAISDAAQLPQDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGALIEDSKVEVNNLNNLNNHDRKHAVGDEAQFEMDI
|
biopax3:standardName |
Eukaryotic translation initiation factor 4E-binding protein 2
|