| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Promotes cell survival. Blocks dexamethasone-induced apoptosis. Mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX. SUBCELLULAR LOCATION: Mitochondrion membrane; Peripheral membrane protein (By similarity). Note=Loosely associated with the mitochondrial membrane in healthy cells. During apoptosis, tightly bound to the membrane (By similarity). ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P70345-1; Sequence=Displayed; Name=2; IsoId=P70345-2; Sequence=VSP_014780; Note=Ref.4 (BAB28740) sequence is in conflict in position: 177:K->R; TISSUE SPECIFICITY: Expressed in almost all myeloid cell lines and in a wide range of tissues, with highest levels in brain, colon, and salivary gland. DEVELOPMENTAL STAGE: Expressed in both mitotic and postmitotic Sertoli cells. INDUCTION: By Igf1. DOMAIN: The BH4 motif seems to be involved in the anti-apoptotic function. DOMAIN: The BH1 and BH2 motifs form a hydrophobic groove which acts as a docking site for the BH3 domain of some pro-apoptotic proteins. The C-terminal residues of BCL2L2 fold into the BH3- binding cleft and modulate pro-survival activity by regulating ligand access. When BH3 domain-containing proteins bind, they displace the C-terminus, allowing its insertion into the membrane and neutralizing the pro-survival activity of BCL2L2 (By similarity). DISRUPTION PHENOTYPE: Mice are sterile due to arrest in spermatogenesis associated with a gradual loss of germ and Sertoli cells from the testis. SIMILARITY: Belongs to the Bcl-2 family. SEQUENCE CAUTION: Sequence=BAD32203.1; Type=Frameshift; Positions=191; GENE SYNONYMS:Bcl2l2 Bclw Kiaa0271. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 193 AA; 20790 MW; 36CA185F5945DFB4 CRC64;
|
| biopax3:xref |
urn:biopax:RelationshipXref:MOUSE GENOME DATABASE_MGI:108052,
urn:biopax:RelationshipXref:NCBI GENE_12050,
urn:biopax:RelationshipXref:REFSEQ_NP_031563,
urn:biopax:UnificationXref:UNIPROT_P70345,
urn:biopax:UnificationXref:UNIPROT_Q545Q4,
urn:biopax:UnificationXref:UNIPROT_Q6A093,
urn:biopax:UnificationXref:UNIPROT_Q8CFR2,
urn:biopax:UnificationXref:UNIPROT_Q8CGL4,
urn:biopax:UnificationXref:UNIPROT_Q9CYW5
|
| biopax3:displayName |
B2CL2_MOUSE
|
| biopax3:name |
Apoptosis regulator Bcl-W,
Bcl2-L-2,
Bcl2l2,
c98
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
|
| biopax3:standardName |
Bcl-2-like protein 2
|