| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Involved in the targeting and/or fusion of transport vesicles to their target membrane. SUBUNIT: Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. This complex binds to CPLX1. Interacts with VAPA and VAPB (By similarity). Interacts with BVES and STX4. SUBCELLULAR LOCATION: Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell junction, synapse, synaptosome. Note=Neuronal synaptic vesicles. SIMILARITY: Belongs to the synaptobrevin family. SIMILARITY: Contains 1 v-SNARE coiled-coil homology domain. GENE SYNONYMS:Vamp2 Syb2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 116 AA; 12691 MW; 4A0D0D56B5409D0A CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
VAMP2_MOUSE
|
| biopax3:name |
Synaptobrevin-2,
VAMP-2,
Vamp2
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
|
| biopax3:standardName |
Vesicle-associated membrane protein 2
|