| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Involved in the targeting and/or fusion of transport vesicles to their target membrane. SUBUNIT: Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. This complex binds to CPLX1. Interacts with BVES and STX4 (By similarity). Interacts with VAPA and VAPB. SUBCELLULAR LOCATION: Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell junction, synapse, synaptosome. Note=Neuronal synaptic vesicles. TISSUE SPECIFICITY: Nervous system and skeletal muscle. SIMILARITY: Belongs to the synaptobrevin family. SIMILARITY: Contains 1 v-SNARE coiled-coil homology domain. GENE SYNONYMS:VAMP2 SYB2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 116 AA; 12663 MW; 9CD679C4F6F1B5A8 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
VAMP2_HUMAN
|
| biopax3:name |
Synaptobrevin-2,
VAMP-2,
VAMP2
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
|
| biopax3:standardName |
Vesicle-associated membrane protein 2
|