| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2L/RBP10 is part of the core element with the central large cleft (By similarity). SUBUNIT: Component of the RNA polymerase I (Pol I), RNA polymerase II (Pol II) and RNA polymerase III (Pol III) complexes consisting of at least 13, 12 and 17 subunits, respectively (By similarity). SUBCELLULAR LOCATION: Nucleus. SIMILARITY: Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family. GENE SYNONYMS:POLR2L. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 67 AA; 7645 MW; 9E8A72F667FE7EC5 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
RPAB5_HUMAN
|
| biopax3:name |
DNA-directed RNA polymerase III subunit L,
POLR2L,
RNA polymerase II 7.6 kDa subunit,
RNA polymerases I, II, and III subunit ABC5,
RPB10 homolog,
RPB7.6
|
| biopax3:organism | |
| biopax3:sequence |
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
|
| biopax3:standardName |
DNA-directed RNA polymerases I, II, and III subunit RPABC5
|