| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: p35 is a neuron specific activator of CDK5. The complex p35/CDK5 is required for neurite outgrowth and cortical lamination. Involved in dendritic spine morphogenesis by mediating the EFNA1-EPHA4 signaling. Activator of TPKII. SUBUNIT: Heterodimer composed of CDK5 and CDK5R (p25) and macromolecular complex composed of at least CDK5, CDK5R (p35) and CDK5RAP1 or CDK5RAP2 or CDK5RAP3. Only the heterodimer shows kinase activity (By similarity). Interacts with RASGRF2. Interacts with EPHA4 and NGEF; may mediate the activation of NGEF by EPHA4. SUBCELLULAR LOCATION: Cyclin-dependent kinase 5 activator 1, p35: Cell membrane; Lipid-anchor; Cytoplasmic side (By similarity). SUBCELLULAR LOCATION: Cyclin-dependent kinase 5 activator 1, p25: Nucleus (By similarity). Cytoplasm, perinuclear region (By similarity). Note=The conversion of p35 to p25 relocalizes the protein from the cell periphery to the cytoplasm, in nuclear and perinuclear regions (By similarity). TISSUE SPECIFICITY: Brain and neuron specific. PTM: The p35 form is proteolytically cleaved by calpain, giving rise to the p25 form. P35 has a 5 to 10 fold shorter half-life compared to p25. The conversion results in deregulation of the CDK5 kinase: p25/CDK5 kinase displays an increased and altered tau phosphorylation in comparison to the p35/CDK5 kinase in vivo. PTM: Myristoylated. A proper myristoylation signal is essential for the proper distribution of p35 (By similarity). PTM: Ubiquitinated. Degradation of p35 by proteasome results in down-regulation of CDK5 activity. During this process, CDK5 phosphorylates p35 and induces its ubiquitination and subsequent degradation (By similarity). PTM: Phosphorylation at Ser-8 and Thr-138 by CDK5 prevents calpain-mediated proteolysis (By similarity). SIMILARITY: Belongs to the cyclin-dependent kinase 5 activator family. GENE SYNONYMS:Cdk5r1 Cdk5r. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 307 AA; 34031 MW; 165AA0747410B0C0 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
CD5R1_RAT
|
| biopax3:name |
CDK5 activator 1,
Cdk5r1,
Cyclin-dependent kinase 5 activator 1, p25,
Cyclin-dependent kinase 5 activator 1, p35,
Cyclin-dependent kinase 5 regulatory subunit 1,
TPKII regulatory subunit,
Tau protein kinase II 23 kDa subunit,
p23,
p25,
p35
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKAQPNSSYQSNIAHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGVSSSVKKAPHPAITSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR
|
| biopax3:standardName |
Cyclin-dependent kinase 5 activator 1
|