| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2F/RPB6 is part of the clamp element and togther with parts of RPB1 and RPB2 forms a pocket to which the RPB4-RPB7 subcomplex binds (By similarity). SUBUNIT: Component of the RNA polymerase I (Pol I), RNA polymerase II (Pol II) and RNA polymerase III (Pol III) complexes consisting of at least 13, 12 and 17 subunits, respectively (By similarity). SUBCELLULAR LOCATION: Nucleus (By similarity). SIMILARITY: Belongs to the archaeal rpoK/eukaryotic RPB6 RNA polymerase subunit family. GENE SYNONYMS:Polr2f. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 127 AA; 14464 MW; 6366A0D7EB3F0921 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
RPAB2_MOUSE
|
| biopax3:name |
DNA-directed RNA polymerase II subunit F,
Polr2f,
RNA polymerases I, II, and III subunit ABC2,
RPB6 homolog
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIISD
|
| biopax3:standardName |
DNA-directed RNA polymerases I, II, and III subunit RPABC2
|