| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=4; Comment=Experimental confirmation may be lacking for some isoforms; Name=A; IsoId=P57077-1; Sequence=Displayed; Name=B; IsoId=P57077-2; Sequence=VSP_004142, VSP_004143; Note=May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay; Name=C; IsoId=P57077-3; Sequence=VSP_004144, VSP_004145; Note=May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay; Name=D; IsoId=P57077-4; Sequence=VSP_004140, VSP_004141; TISSUE SPECIFICITY: Detected in lung and peripheral blood leukocytes. Expressed predominantly in peripheral blood leukocytes and ubiquitously in adult and fetal tissues. Also expressed strongly in breast carcinoma GI-101, colon adenocarcinoma GI-112, and prostatic adenocarcinoma PC3. SIMILARITY: To the C-terminal domain of MAP3K7. SEQUENCE CAUTION: Sequence=CAB90434.1; Type=Erroneous gene model prediction; GENE SYNONYMS:TAK1L C21orf7. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 242 AA; 27248 MW; FFED148FE9AB838C CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
TAK1L_HUMAN
|
| biopax3:name |
TAK1L
|
| biopax3:organism | |
| biopax3:sequence |
MVQLIAPLEVMWNEAADLKPLALSRRLECSGGIMAHYSPDLLGPEMESRYFAQVGLEHLASSSPPAFGFLKCLDYSISVLCSATSLAMLEDNPKVSKLATGDWMLTLKPKSITVPVEIPSSPLDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS
|
| biopax3:standardName |
TAK1-like protein
|