| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein Transport via Transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrrounded by clathrin (clathrin- coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. The AP-2 alpha and AP-2 sigma subunits are thought to contribute to the recognition of the [ED]-X-X-X-L-[LI] motif (By similarity). SUBUNIT: Adaptor protein complex 2 (AP-2) is an heterotetramer composed of two large adaptins (alpha-type subunit AP2A1 or AP2A2 and beta-type subunit AP2B1), a medium adaptin (mu-type subunit AP2M1) and a small adaptin (sigma-type subunit AP2S1). SUBCELLULAR LOCATION: Cell membrane. Membrane, coated pit; Peripheral membrane protein; Cytoplasmic side. Note=AP-2 appears to be excluded from internalizing CCVs and to disengage from sites of endocytosis seconds before internalization of the nascent CCV (By similarity). ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P53680-1; Sequence=Displayed; Name=2; IsoId=P53680-2; Sequence=VSP_017352; SIMILARITY: Belongs to the adaptor complexes small subunit family. GENE SYNONYMS:AP2S1 AP17 CLAPS2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 142 AA; 17018 MW; CA3FD868C65AEDF6 CRC64;
|
| biopax3:xref |
urn:biopax:RelationshipXref:HGNC_HGNC:565,
urn:biopax:RelationshipXref:NCBI GENE_1175,
urn:biopax:RelationshipXref:REFSEQ_NP_004060,
urn:biopax:RelationshipXref:REFSEQ_NP_067586,
urn:biopax:UnificationXref:UNIPROT_B2R4Z4,
urn:biopax:UnificationXref:UNIPROT_O75977,
urn:biopax:UnificationXref:UNIPROT_P53680,
urn:biopax:UnificationXref:UNIPROT_Q6PK67
|
| biopax3:displayName |
AP2S1_HUMAN
|
| biopax3:name |
AP2S1,
Adapter-related protein complex 2 sigma subunit,
Adaptor protein complex AP-2 subunit sigma,
Clathrin assembly protein 2 small chain,
Clathrin coat assembly protein AP17,
Clathrin coat-associated protein AP17,
HA2 17 kDa subunit,
Plasma membrane adaptor AP-2 17 kDa protein,
Sigma2-adaptin
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
|
| biopax3:standardName |
AP-2 complex subunit sigma
|