| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. SUBUNIT: Component of the RNA polymerase I (Pol I), RNA polymerase II (Pol II) and RNA polymerase III (Pol III) complexes consisting of at least 13, 12 and 17 subunits, respectively (By similarity). SUBCELLULAR LOCATION: Nucleus, nucleolus. SIMILARITY: Belongs to the eukaryotic RPB8 RNA polymerase subunit family. GENE SYNONYMS:POLR2H. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 150 AA; 17143 MW; 944D0860809F1425 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
RPAB3_HUMAN
|
| biopax3:name |
DNA-directed RNA polymerase II subunit H,
DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide,
POLR2H,
RNA polymerases I, II, and III subunit ABC3,
RPB17,
RPB8 homolog,
hRPB8
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
|
| biopax3:standardName |
DNA-directed RNA polymerases I, II, and III subunit RPABC3
|