| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
SEQUENCE 338 AA; 38429 MW; 905D2EBD370CC59D CRC64;,
SUBUNIT: Binds to laminin (By similarity). SUBCELLULAR LOCATION: Secreted, extracellular space, extracellular matrix (By similarity). TISSUE SPECIFICITY: Cornea and other tissues. DEVELOPMENTAL STAGE: Present in the extracellular matrix of human articular cartilage at all ages, although its abundance is far greater in the adult. In the adult cartilage lumican exists predominantly in a glycoprotein form lacking keratan sulfate, whereas the juvenile form of the molecule is a proteoglycan. PTM: Sulfated on tyrosine residue(s). SIMILARITY: Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class II subfamily. SIMILARITY: Contains 11 LRR (leucine-rich) repeats. SIMILARITY: Contains 1 LRRNT domain. GENE SYNONYMS:LUM LDC SLRR2D. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.
|
| biopax3:xref | |
| biopax3:displayName |
LUM_HUMAN
|
| biopax3:name |
KSPG lumican,
Keratan sulfate proteoglycan lumican,
LUM
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
|
| biopax3:standardName |
Lumican
|