Statements in which the resource exists as a subject.
PredicateObject
rdf:type
biopax3:comment
FUNCTION: Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation. SUBUNIT: Component of the SNARE complex composed of STX4, SNAP23 and VAMP7 that binds SYT7 during lysosomal exocytosis. Component of the SNARE complex composed of STX7, STX8, VAMP7 and VTI1B that is required for heterotypic fusion of late endosomes with lysosomes in liver cells (By similarity). SUBCELLULAR LOCATION: Cytoplasmic vesicle, secretory vesicle membrane; Single-pass type IV membrane protein (By similarity). Golgi apparatus, trans-Golgi network membrane; Single-pass type IV membrane protein (By similarity). Late endosome membrane; Single- pass type IV membrane protein (By similarity). Lysosome membrane; Single-pass type IV membrane protein. Endoplasmic reticulum membrane; Single-pass type IV membrane protein (By similarity). Cytoplasmic vesicle, phagosome membrane; Single-pass type IV membrane protein (By similarity). ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=Ti-VAMPa/VAMP7a; IsoId=P51809-1; Sequence=Displayed; Name=2; Synonyms=Ti-VAMPb/VAMP7b; IsoId=P51809-2; Sequence=VSP_017509; Name=3; Synonyms=Ti-VAMPc/VAMP7c; IsoId=P51809-3; Sequence=VSP_017508; TISSUE SPECIFICITY: Detected in all tissues tested. MISCELLANEOUS: The gene encoding for this protein is located in the pseudoautosomal region 2 (PAR2) of X and Y chromosomes. MISCELLANEOUS: Loss-of-function mutant (antisense inhibition) displays impaired granzyme B release and target cell killing by natural killer cells. SIMILARITY: Belongs to the synaptobrevin family. SIMILARITY: Contains 1 longin domain. SIMILARITY: Contains 1 v-SNARE coiled-coil homology domain. SEQUENCE CAUTION: Sequence=BI547528; Type=Miscellaneous discrepancy; Note=Sequence of unknown origin in the C-terminal part; GENE SYNONYMS:VAMP7 SYBL1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 220 AA; 24935 MW; 9C1AA5C590375CEF CRC64;
biopax3:xref
biopax3:displayName
VAMP7_HUMAN
biopax3:name
Synaptobrevin-like protein 1, Tetanus-insensitive VAMP, Ti-VAMP, VAMP-7, VAMP7
biopax3:entityFeature
biopax3:organism
biopax3:sequence
MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNLKLTIIIIIVSIVFIYIIVSPLCGGFTWPSCVKK
biopax3:standardName
Vesicle-associated membrane protein 7