| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Ligand-gated ion channel with relatively high calcium permeability. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Seems to be linked to apoptosis, by increasing the intracellular concentration of calcium in the presence of ATP, leading to programmed cell death (By similarity). SUBUNIT: Homo- or heteropolymers (By similarity). SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. SIMILARITY: Belongs to the P2X receptor family. WEB RESOURCE: Name=Wikipedia; Note=P2X receptor entry; URL="http://en.wikipedia.org/wiki/P2X_receptor"; WEB RESOURCE: Name=Wikipedia; Note=P2RX1 entry; URL="http://en.wikipedia.org/wiki/P2RX1"; GENE SYNONYMS:P2RX1 P2X1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 399 AA; 44980 MW; 8365466665522BF8 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
P2RX1_HUMAN
|
| biopax3:name |
ATP receptor,
P2RX1,
P2X1,
Purinergic receptor
|
| biopax3:organism | |
| biopax3:sequence |
MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSGLISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEHPEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENGTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS
|
| biopax3:standardName |
P2X purinoceptor 1
|