Linked Life Data

P49798

Source:http://identifiers.org/uniprot/P49798

Statements in which the resource exists as a subject.
PredicateObject
rdf:type
biopax3:comment
FUNCTION: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(z)-alpha is inhibited by phosphorylation of the G-protein. Activity on G(z)-alpha and G(i)-alpha-1 is inhibited by palmitoylation of the G-protein. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=5; Comment=May be produced by alternative promoter usage; Name=1; Synonyms=B; IsoId=P49798-1; Sequence=Displayed; Name=2; Synonyms=A; IsoId=P49798-2; Sequence=VSP_043856; Name=3; Synonyms=C; IsoId=P49798-3; Sequence=VSP_043853; Name=4; IsoId=P49798-4; Sequence=VSP_043855; Name=5; IsoId=P49798-5; Sequence=VSP_043854; TISSUE SPECIFICITY: Expressed in brain and heart. Expressed in brain at protein level. Expressed in prefontal and visual cortex. Isoform 4 and isoform 5 are expressed ubiquitously. Isoform 1, isoform 2 and isoform 3 are not expressed in the cerebellum. PTM: Palmitoylated on Cys-2 and/or Cys-12. PTM: Phosphorylated by cyclic GMP-dependent protein kinase (By similarity). DISEASE: Genetic variation in RGS4 is associated with susceptibility to schizophrenia type 9 (SCZD9) [MIM:604906]. A complex, multifactorial psychotic disorder or group of disorders characterized by disturbances in the form and content of thought (e.g. delusions, hallucinations), in mood (e.g. inappropriate affect), in sense of self and relationship to the external world (e.g. loss of ego boundaries, withdrawal), and in behavior (e.g bizarre or apparently purposeless behavior). Although it affects emotions, it is distinguished from mood disorders in which such disturbances are primary. Similarly, there may be mild impairment of cognitive function, and it is distinguished from the dementias in which disturbed cognitive function is considered primary. Some patients manifest schizophrenic as well as bipolar disorder symptoms and are often given the diagnosis of schizoaffective disorder. SIMILARITY: Contains 1 RGS domain. GENE SYNONYMS:RGS4. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 205 AA; 23256 MW; 7713F1F7496A698B CRC64;
biopax3:xref
biopax3:displayName
RGS4_HUMAN
biopax3:name
RGP4, RGS4
biopax3:organism
biopax3:sequence
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA
biopax3:standardName
Regulator of G-protein signaling 4