| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit has a trypsin-like activity. CATALYTIC ACTIVITY: Cleavage of peptide bonds with very broad specificity. SUBUNIT: The 26S proteasome consists of a 20S proteasome core and two 19S regulatory subunits. The 20S proteasome core is composed of 28 subunits that are arranged in four stacked rings, resulting in a barrel-shaped structure. The two end rings are each formed by seven alpha subunits, and the two central rings are each formed by seven beta subunits. The catalytic chamber with the active sites is on the inside of the barrel. Interacts with HIV-1 TAT protein. SUBCELLULAR LOCATION: Cytoplasm. Nucleus. INDUCTION: Up-regulated in ovarian cancer cell lines. SIMILARITY: Belongs to the peptidase T1B family. GENE SYNONYMS:PSMB2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 201 AA; 22836 MW; 04D085D7BAA76130 CRC64;
|
| biopax3:xref |
urn:biopax:RelationshipXref:HGNC_HGNC:9539,
urn:biopax:RelationshipXref:NCBI GENE_5690,
urn:biopax:RelationshipXref:REFSEQ_NP_002785,
urn:biopax:UnificationXref:UNIPROT_D3DPS0,
urn:biopax:UnificationXref:UNIPROT_P31145,
urn:biopax:UnificationXref:UNIPROT_P49721,
urn:biopax:UnificationXref:UNIPROT_Q9BWZ9
|
| biopax3:displayName |
PSB2_HUMAN
|
| biopax3:name |
3.4.25.1,
Macropain subunit C7-I,
Multicatalytic endopeptidase complex subunit C7-I,
PSMB2,
Proteasome component C7-I
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
|
| biopax3:standardName |
Proteasome subunit beta type-2
|