| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Catalyzes the transfer of PtdIns and phosphatidylcholine between membranes. SUBCELLULAR LOCATION: Cytoplasm (By similarity). Golgi apparatus (By similarity). ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P48739-1; Sequence=Displayed; Name=2; IsoId=P48739-2; Sequence=VSP_012762; TISSUE SPECIFICITY: Widely expressed in various tissues including brain. PTM: Constitutive phosphorylation of Ser-262 has no effect on phospholipid transfer activity but is required for Golgi targeting (By similarity). SIMILARITY: Belongs to the PtdIns transfer protein family. PI transfer class I subfamily. GENE SYNONYMS:PITPNB. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 271 AA; 31540 MW; AC5333FBC0F6CA06 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
PIPNB_HUMAN
|
| biopax3:name |
PI-TP-beta,
PITPNB,
PtdIns transfer protein beta,
PtdInsTP beta
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV
|
| biopax3:standardName |
Phosphatidylinositol transfer protein beta isoform
|