| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Guanine-nucleotide-releasing protein that acts on members of the SCE4/YPT1/RAB subfamily. Stimulates GDP release from both YPT1 and RAB3A, but is less active on these proteins than on the SEC4 protein. Might play a general role in vesicular transport. TISSUE SPECIFICITY: Ubiquitous. SIMILARITY: Belongs to the DSS4/MSS4 family. GENE SYNONYMS:RABIF MSS4 RASGRF3. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 123 AA; 13839 MW; 78E98395FAE10257 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
MSS4_HUMAN
|
| biopax3:name |
RABIF,
Rab-interacting factor
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE
|
| biopax3:standardName |
Guanine nucleotide exchange factor MSS4
|