Statements in which the resource exists as a subject.
PredicateObject
rdf:type
biopax3:comment
FUNCTION: Catalyzes the conversion of aldehydes and ketones to alcohols. Catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ) and the oxidation of 9-alpha,11-beta- PGF2 to PGD2. Functions as a bi-directional 3-alpha-, 17-beta- and 20-alpha HSD. Can interconvert active androgens, estrogens and progestins with their cognate inactive metabolites. Preferentially transforms androstenedione (4-dione) to testosterone. CATALYTIC ACTIVITY: Trans-1,2-dihydrobenzene-1,2-diol + NADP(+) = catechol + NADPH. CATALYTIC ACTIVITY: Androsterone + NAD(P)(+) = 5-alpha-androstane- 3,17-dione + NAD(P)H. CATALYTIC ACTIVITY: (5Z,13E)-(15S)-9-alpha,11-alpha,15- trihydroxyprosta-5,13-dienoate + NADP(+) = (5Z,13E)-(15S)-9- alpha,15-dihydroxy-11-oxoprosta-5,13-dienoate + NADPH. CATALYTIC ACTIVITY: Testosterone + NAD(+) = androst-4-ene-3,17- dione + NADH. CATALYTIC ACTIVITY: Testosterone + NADP(+) = androst-4-ene-3,17- dione + NADPH. CATALYTIC ACTIVITY: Indan-1-ol + NAD(P)(+) = indanone + NAD(P)H. ENZYME REGULATION: Strongly inhibited by nonsteroidal anti- inflammatory drugs (NSAID) including flufenamic acid and indomethacin. Also inhibited by the flavinoid, rutin, and by selective serotonin inhibitors (SSRIs). BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=142.1 uM for progesterone; KM=2.37 uM for 5-alpha-dihydrotestosterone; KM=1.0 uM for androstanediol; Vmax=20.1 nmol/min/mg enzyme with progesterone as substrate; Vmax=1.8 nmol/min/mg enzyme with 5-alpha-dihydrotestosterone as substrate; Vmax=4.4 nmol/min/mg enzyme with androstanediol as substrate; SUBCELLULAR LOCATION: Cytoplasm. TISSUE SPECIFICITY: Expressed in many tissues including adrenal gland, brain, kidney, liver, lung, mammary gland, placenta, small intestine, colon, spleen, prostate and testis. The dominant HSD in prostate and mammary gland. In the prostate, higher levels in epithelial cells than in stromal cells. In the brain, expressed in medulla, spinal cord, frontotemporal lobes, thalamus, subthalamic nuclei and amygdala. Weaker expression in the hippocampus, substantia nigra and caudate. SIMILARITY: Belongs to the aldo/keto reductase family. SEQUENCE CAUTION: Sequence=BAA04619.2; Type=Erroneous initiation; Note=Translation N-terminally extended; WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/AKR1C3ID612ch10p15.html"; GENE SYNONYMS:AKR1C3 DDH1 HSD17B5 KIAA0119 PGFS. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 323 AA; 36853 MW; 86A7690D9498C6FD CRC64;
biopax3:xref
biopax3:displayName
AK1C3_HUMAN
biopax3:name
1.-.-.-, 1.1.1.112, 1.1.1.188, 1.1.1.213, 1.1.1.63, 1.1.1.64, 1.3.1.20, 17-beta-HSD 5, 17-beta-hydroxysteroid dehydrogenase type 5, 3-alpha-HSD type 2, 3-alpha-HSD type II, brain, 3-alpha-hydroxysteroid dehydrogenase type 2, AKR1C3, Chlordecone reductase homolog HAKRb, DD-3, DD3, Dihydrodiol dehydrogenase 3, Dihydrodiol dehydrogenase type I, HA1753, Indanol dehydrogenase, PGFS, Prostaglandin F synthase, Testosterone 17-beta-dehydrogenase 5, Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
biopax3:organism
biopax3:sequence
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
biopax3:standardName
Aldo-keto reductase family 1 member C3