| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: May play a role in growth regulation. Is associated with G2/M phase arrest in response to DNA damage. May be an intermediate by which p53 mediates its role as an inhibitor of cellular proliferation. SUBCELLULAR LOCATION: Nucleus (By similarity). DEVELOPMENTAL STAGE: Induced within 3 hours after growth stimulation, remains elevated with no apparent cell cycle dependency. INDUCTION: By doxorubicin (DOX). SIMILARITY: Belongs to the cyclin family. Cyclin G subfamily. GENE SYNONYMS:Ccng1 Ccng. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 294 AA; 33934 MW; 229A5588E66F0DBC CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
CCNG1_RAT
|
| biopax3:name |
Ccng1,
Cyclin-G
|
| biopax3:organism | |
| biopax3:sequence |
MIEVLTTDSQKLLHQLNTLLEQESRCQPKVCGLKLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDTETFSLAVNLLDRFLSKMKVQAKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEKIVLEKVCWKVKATTAFQFLQLYYSLIRETLPFERRNDLNFERLEAQLKACHCRIIFSKAKPSVLALAIIALEIQALKYVELTEGVECIQKHSKISGRDLTFWQELVSKCLTEYSSNKCSKPNGQKLKWIVSGRTARQLKHSYYRITHLPTIPETMG
|
| biopax3:standardName |
Cyclin-G1
|