| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Implicated in a number of cellular processes, including proliferation, differentiation, caspase-dependent and caspase- independent apoptosis, suppression of transformation (tumor suppressor), inhibition of protein phosphatase 2A, regulation of mRNA trafficking and stability in association with ELAVL1, and inhibition of acetyltransferases as part of the INHAT (inhibitor of histone acetyltransferases) complex. Plays a role in E4F1- mediated transcriptional repression. SUBUNIT: Component of the SET complex, which also contains SET, APEX1, HMGB2 and NME1. Directly interacts with SET. Interacts with ATXN1/SCA1. Interacts with MAP1B (By similarity). Interacts with ELAVL1. Part of the INHAT (inhibitor of histone acetyltransferases) complex. Interacts with E4F1. SUBCELLULAR LOCATION: Nucleus. Cytoplasm. Endoplasmic reticulum. Note=Translocates to the cytoplasm during the process of neuritogenesis (By similarity). Shuttles between nucleus and cytoplasm. TISSUE SPECIFICITY: Expressed in all tissues tested. Highly expressed in kidney and skeletal muscle, moderate levels of expression in brain, placenta and pancreas, and weakly expressed in lung. Found in all regions of the brain examined (amygdala, caudate nucleus, corpus callosum, hippocampus and thalamus), with highest levels in amygdala. PTM: Phosphorylated on serine residues. PTM: The N-terminus is blocked. PTM: Some glutamate residues are glycylated by TTLL8. This modification occurs exclusively on glutamate residues and results in a glycine chain on the gamma-carboxyl group (By similarity). SIMILARITY: Belongs to the ANP32 family. SIMILARITY: Contains 4 LRR (leucine-rich) repeats. SIMILARITY: Contains 1 LRRCT domain. SEQUENCE CAUTION: Sequence=BAD97000.1; Type=Erroneous initiation; GENE SYNONYMS:ANP32A C15orf1 LANP MAPM PHAP1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 249 AA; 28585 MW; CA2D1A756FBAEA04 CRC64;
|
| biopax3:xref |
urn:biopax:RelationshipXref:HGNC_HGNC:13233,
urn:biopax:RelationshipXref:NCBI GENE_8125,
urn:biopax:RelationshipXref:REFSEQ_NP_006296,
urn:biopax:UnificationXref:UNIPROT_B2R6T4,
urn:biopax:UnificationXref:UNIPROT_P39687,
urn:biopax:UnificationXref:UNIPROT_Q53FK4,
urn:biopax:UnificationXref:UNIPROT_Q5J8L8,
urn:biopax:UnificationXref:UNIPROT_Q7M4N6
|
| biopax3:displayName |
AN32A_HUMAN
|
| biopax3:name |
ANP32A,
Acidic nuclear phosphoprotein pp32,
LANP,
Leucine-rich acidic nuclear protein,
Mapmodulin,
PHAPI,
Potent heat-stable protein phosphatase 2A inhibitor I1PP2A,
Putative HLA-DR-associated protein I
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
|
| biopax3:standardName |
Acidic leucine-rich nuclear phosphoprotein 32 family member A
|