| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1 (By similarity). Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity. May play a role in a functional FA core complex response to DNA cross- link damage, being required for the stability and nuclear localization of FA core complex proteins, as well as for FANCD2 monoubiquitination in response to DNA damage (By similarity). SUBUNIT: Interacts with SIRT1 (By similarity). Transcription repression requires formation of a complex with a corepressor protein of the Groucho/TLE family. Interacts (via WPRW motif) with TLE1, and more weakly with TLE2. Interacts with HES6. Interacts with an FA complex, composed of FANCA, FANCF, FANCG and FANCL, but not of FANCC, nor FANCE (By similarity). SUBCELLULAR LOCATION: Nucleus. TISSUE SPECIFICITY: Expressed at high levels in undifferentiated neural precursor cells, but the level of expression decreases as neural differentiation proceeds. DOMAIN: Has a particular type of basic domain (presence of a helix-interrupting proline) that binds to the N-box (CACNAG), rather than the canonical E-box (CANNTG). DOMAIN: The C-terminal WRPW motif is a transcriptional repression domain necessary for the interaction with Groucho/TLE family members, transcriptional corepressors recruited to specific target DNA by Hairy-related proteins. DOMAIN: The bHLH, as well as cooperation between the central Orange domain and the C-terminal WRPW motif, is required for transcriptional repressor activity (By similarity). SIMILARITY: Contains 1 basic helix-loop-helix (bHLH) domain. SIMILARITY: Contains 1 Orange domain. GENE SYNONYMS:Hes1 Hes-1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 282 AA; 29749 MW; 88C7700C5EF7DA26 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
HES1_MOUSE
|
| biopax3:name |
Hairy and enhancer of split 1,
Hes1
|
| biopax3:organism | |
| biopax3:sequence |
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQAHPALQAPPPPPPSGPAGPQHAPFAPPPPPLVPIPGGAAPPPGSAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTSDSMWRPWRN
|
| biopax3:standardName |
Transcription factor HES-1
|