| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway (By similarity). FUNCTION: p53-regulated inhibitor of G2/M progression. SUBUNIT: Homodimer. Interacts with KRT17 and SAMSN1 (By similarity). Found in a complex with XPO7, EIF4A1, ARHGAP1, VPS26A, VPS29, VPS35 and SFN. Interacts with GAB2. Interacts with SRPK2. SUBCELLULAR LOCATION: Cytoplasm. Nucleus (By similarity). Secreted. Note=May be secreted by a non-classical secretory pathway. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P31947-1; Sequence=Displayed; Name=2; IsoId=P31947-2; Sequence=VSP_021768; Note=No experimental confirmation available; TISSUE SPECIFICITY: Present mainly in tissues enriched in stratified squamous keratinizing epithelium. SIMILARITY: Belongs to the 14-3-3 family. GENE SYNONYMS:SFN HME1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 248 AA; 27774 MW; 7F4B44E3AA59ECE6 CRC64;
|
| biopax3:xref |
urn:biopax:RelationshipXref:HGNC_HGNC:10773,
urn:biopax:RelationshipXref:NCBI GENE_2810,
urn:biopax:RelationshipXref:REFSEQ_NP_006133,
urn:biopax:UnificationXref:UNIPROT_P31947,
urn:biopax:UnificationXref:UNIPROT_Q6FH30,
urn:biopax:UnificationXref:UNIPROT_Q6FH51,
urn:biopax:UnificationXref:UNIPROT_Q96DH0
|
| biopax3:displayName |
1433S_HUMAN
|
| biopax3:name |
Epithelial cell marker protein 1,
SFN,
Stratifin
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
|
| biopax3:standardName |
14-3-3 protein sigma
|