| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: SNC1 and SNC2 are vesicle-targeting proteins essential for normal secretory traffic between the Golgi and the plasma membrane. They may also be involved in vesicle fusion. SUBCELLULAR LOCATION: Endomembrane system; Single-pass type IV membrane protein. Note=Post-Golgi vesicle membrane (Probable). PTM: Palmitoylated by SWF1. SIMILARITY: Belongs to the synaptobrevin family. SIMILARITY: Contains 1 v-SNARE coiled-coil homology domain. GENE SYNONYMS:SNC1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 117 AA; 13201 MW; 662C3DB5C8D44A94 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
SNC1_YEAST
|
| biopax3:name |
SNC1
|
| biopax3:organism | |
| biopax3:sequence |
MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKMCLALVIIILLVVIIVPIAVHFSR
|
| biopax3:standardName |
Synaptobrevin homolog 1
|