| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Regulatory component of the cyclin D3-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D3/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex. SUBUNIT: Interacts with the CDK4 and CDK6 protein kinases to form a serine/threonine kinase holoenzyme complex. The cyclin subunit imparts substrate specificity to the complex. Interacts with ATF5. Interacts with EIF3K. Component of the ternary complex cyclin D/CDK4/CDKN1B required for nuclear translocation and modulation of CDK4-mediated kinase activity. Can form similar complexes with either CDKN1A or CDKN2A. SUBCELLULAR LOCATION: Nucleus. Cytoplasm. Membrane. Note=Cyclin D- CDK4 complexes accumulate at the nuclear membrane and are then translocated to the nucleus through interaction with KIP/CIP family members (By similarity). ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P30281-1; Sequence=Displayed; Name=2; IsoId=P30281-2; Sequence=VSP_042649; Note=No experimental confirmation available; SIMILARITY: Belongs to the cyclin family. Cyclin D subfamily. SIMILARITY: Contains 1 cyclin N-terminal domain. WEB RESOURCE: Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/ccnd3/"; GENE SYNONYMS:CCND3. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 292 AA; 32520 MW; 16E7B1604FEB0029 CRC64;
|
| biopax3:xref |
urn:biopax:RelationshipXref:HGNC_HGNC:1585,
urn:biopax:RelationshipXref:NCBI GENE_896,
urn:biopax:RelationshipXref:REFSEQ_NP_001129489,
urn:biopax:RelationshipXref:REFSEQ_NP_001129597,
urn:biopax:RelationshipXref:REFSEQ_NP_001129598,
urn:biopax:RelationshipXref:REFSEQ_NP_001751,
urn:biopax:UnificationXref:UNIPROT_B2RD63,
urn:biopax:UnificationXref:UNIPROT_B3KQ22,
urn:biopax:UnificationXref:UNIPROT_P30281,
urn:biopax:UnificationXref:UNIPROT_Q5T8J0,
urn:biopax:UnificationXref:UNIPROT_Q6FG62,
urn:biopax:UnificationXref:UNIPROT_Q96F49
|
| biopax3:displayName |
CCND3_HUMAN
|
| biopax3:name |
CCND3
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
|
| biopax3:standardName |
G1/S-specific cyclin-D3
|