| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Binds directly to 26S ribosomal RNA (By similarity). ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P30050-1; Sequence=Displayed; Name=2; IsoId=P30050-2; Sequence=VSP_034695; Note=No experimental confirmation available; SIMILARITY: Belongs to the ribosomal protein L11P family. GENE SYNONYMS:RPL12. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 165 AA; 17819 MW; 7EFD783A8ED350F9 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
RL12_HUMAN
|
| biopax3:name |
RPL12
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS
|
| biopax3:standardName |
60S ribosomal protein L12
|