Predicate | Object |
---|---|
rdf:type | |
biopax3:comment |
FUNCTION: Involved in mating signal transduction pathway. CATALYTIC ACTIVITY: ATP + a protein = ADP + a phosphoprotein. COFACTOR: Magnesium (By similarity). ENZYME REGULATION: Activated by tyrosine and threonine phosphorylation. SUBCELLULAR LOCATION: Nucleus. Note=Mainly nuclear. DOMAIN: The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases. PTM: Dually phosphorylated on Thr-199 and Tyr-201, which activates the enzyme (By similarity). SIMILARITY: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily. SIMILARITY: Contains 1 protein kinase domain. CAUTION: Was originally (PubMed:1899230) thought to confer resistance to staurosporine. GENE SYNONYMS:spk1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 372 AA; 42003 MW; 85D980514C9386C7 CRC64;
|
biopax3:xref | |
biopax3:displayName |
SPK1_SCHPO
|
biopax3:name |
2.7.11.24,
MAP kinase spk1,
MAPK,
spk1
|
biopax3:entityFeature | |
biopax3:organism | |
biopax3:sequence |
MASATSTPTIADGNSNKESVATSRSPHTHDLNFELPEEYEMINLIGQGAYGVVCAALHKPSGLKVAVKKIHPFNHPVFCLRTLREIKLLRHFRHENIISILDILPPPSYQELEDVYIVQELMETDLYRVIRSQPLSDDHCQYFTYQILRALKAMHSAGVVHRDLKPSNLLLNANCDLKVADFGLARSTTAQGGNPGFMTEYVATRWYRAPEIMLSFREYSKAIDLWSTGCILAEMLSARPLFPGKDYHSQITLILNILGTPTMDDFSRIKSARARKYIKSLPFTPKVSFKALFPQASPDAIDLLEKLLTFNPDKRITAEEALKHPYVAAYHDASDEPTASPMPPNLVDLYCNKEDLEIPVLKALIFREVNFR
|
biopax3:standardName |
Mitogen-activated protein kinase spk1
|