| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Receptor for gastrin releasing peptide (GRP). This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Brain (hypothalamus), pancreatic acinar cells, and fibroblasts. SIMILARITY: Belongs to the G-protein coupled receptor 1 family. GENE SYNONYMS:Grpr. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 384 AA; 43215 MW; BF6D60387AA09A2C CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
GRPR_MOUSE
|
| biopax3:name |
GRP-R,
GRP-preferring bombesin receptor,
Grpr
|
| biopax3:organism | |
| biopax3:sequence |
MAPNNCSHLNLDVDPFLSCNDTFNQSLSPPKMDNWFHPGFIYVIPAVYGLIIVIGLIGNITLIKIFCTVKSMRNVPNLFISSLALGDLLLLVTCAPVDASKYLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAALIWIVSMLLAIPEAVFSDLHPFHVKDTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLAIISVYYYFIARNLIQSAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLHFVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLMNRSHSTGRSTTCMTSFKSTNPSATFSLINRNICHEGYV
|
| biopax3:standardName |
Gastrin-releasing peptide receptor
|