| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Transcription factor essential for hepatocyte growth, the differentiation of plasma cells, the immunoglobulin secretion, and the unfolded protein response (UPR). Acts during endoplasmic reticulum stress (ER) by activating unfolded protein response (UPR) target genes via direct binding to the UPR element (UPRE). Binds DNA preferably to the CRE-like element 5'- GATGACGTG[TG]N(3)[AT]T-3', and also to some TPA response elements (TRE). Binds to the HLA DR-alpha promoter. Binds to the Tax- responsive element (TRE) of HTLV-I. SUBCELLULAR LOCATION: Nucleus. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=XBP-1U; IsoId=P17861-1; Sequence=Displayed; Name=2; Synonyms=XBP-1S; IsoId=P17861-2; Sequence=VSP_012936; Note=Potent transcriptional activator. Induced by ERN1 in response to endoplasmic reticulum stress. ENR1 cleaves a 26-bp fragment causing a frameshift of the mRNA transcript; INDUCTION: Up-regulated by ATF6 via direct binding to the ERSE in response to endoplasmic reticulum stress. DISEASE: Genetic variations in XBP1 could be associated with susceptibility to major affective disorder type 7 (MAFD7) [MIM:612371]. Major affective disorders represent a class of mental disorders characterized by a disturbance in mood as their predominant feature. SIMILARITY: Belongs to the bZIP family. SIMILARITY: Contains 1 bZIP domain. GENE SYNONYMS:XBP1 TREB5 XBP2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 261 AA; 28695 MW; A4EF69EEE0D344A6 CRC64;
|
| biopax3:xref |
urn:biopax:RelationshipXref:HGNC_HGNC:12801,
urn:biopax:RelationshipXref:NCBI GENE_7494,
urn:biopax:RelationshipXref:REFSEQ_NP_001073007,
urn:biopax:RelationshipXref:REFSEQ_NP_005071,
urn:biopax:UnificationXref:UNIPROT_P17861,
urn:biopax:UnificationXref:UNIPROT_Q8WYK6,
urn:biopax:UnificationXref:UNIPROT_Q969P1,
urn:biopax:UnificationXref:UNIPROT_Q96BD7
|
| biopax3:displayName |
XBP1_HUMAN
|
| biopax3:name |
Tax-responsive element-binding protein 5,
XBP-1,
XBP1
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN
|
| biopax3:standardName |
X-box-binding protein 1
|