P17096

FUNCTION: HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions. SUBUNIT: Interacts with HIPK2 (By similarity). Interacts with HIV- 1 pre-integration complex. SUBCELLULAR LOCATION: Nucleus. Chromosome. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=3; Name=HMG-I; Synonyms=HMGA1a; IsoId=P17096-1; Sequence=Displayed; Name=HMG-Y; Synonyms=HMGA1b; IsoId=P17096-2; Sequence=VSP_002182; Name=HMG-R; Synonyms=HMGA1c; IsoId=P17096-3; Sequence=VSP_018084; PTM: Constitutively phosphorylated on two or three sites. Phosphorylated upon DNA damage, probably by ATM or ATR. Hyperphosphorylated at early stages of apoptosis, followed by dephosphorylation and methylation, which coincides with chromatin condensation. Isoforms HMG-I and HMG-Y can be phosphorylated by HIPK2. Phosphorylation of HMG-I at Ser-36, Thr-53 and Thr-78 and of HMG-Y at Thr-42 and Thr-67 by HIPK2 modulates DNA-binding affinity. PTM: HMG-Y is not methylated. PTM: Methylation at Arg-58 is mutually exclusive with methylation at Arg-60. MASS SPECTROMETRY: Mass=11750; Mass_error=12; Method=MALDI; Range=2-107 (P17096-1); Note=With 1 acetyl and 2 phosphate groups; Source=PubMed:15302935; MASS SPECTROMETRY: Mass=11828; Mass_error=12; Method=MALDI; Range=2-107 (P17096-1); Note=With 1 acetyl and 3 phosphate groups; Source=PubMed:15302935; MASS SPECTROMETRY: Mass=11765; Mass_error=12; Method=MALDI; Range=2-107 (P17096-1); Note=With 1 acetyl, 1 methyl and 2 phosphate groups; Source=PubMed:15302935; MASS SPECTROMETRY: Mass=11844; Mass_error=12; Method=MALDI; Range=2-107 (P17096-1); Note=With 1 acetyl, 1 methyl and 3 phosphate groups; Source=PubMed:15302935; MASS SPECTROMETRY: Mass=11780; Mass_error=12; Method=MALDI; Range=2-107 (P17096-1); Note=With 1 acetyl, 2 methyl and 2 phosphate groups; Source=PubMed:15302935; MASS SPECTROMETRY: Mass=11858; Mass_error=12; Method=MALDI; Range=2-107 (P17096-1); Note=With 1 acetyl, 2 methyl and 3 phosphate groups; Source=PubMed:15302935; DISEASE: Note=A chromosomal aberration involving HMGA1 is found in pulmonary chondroid hamartoma. Translocation t(6;14)(p21;q23-24) with RAD51B. SIMILARITY: Belongs to the HMGA family. SIMILARITY: Contains 3 A.T hook DNA-binding domains. WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/HMGIYID221.html"; GENE SYNONYMS:HMGA1 HMGIY. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 107 AA; 11676 MW; E9C4E3F2200914B8 CRC64;

HMGA1_HUMAN

urn:biopax:ModificationFeature:HMGA1_HUMAN_1, urn:biopax:ModificationFeature:HMGA1_HUMAN_10, urn:biopax:ModificationFeature:HMGA1_HUMAN_11, urn:biopax:ModificationFeature:HMGA1_HUMAN_12, urn:biopax:ModificationFeature:HMGA1_HUMAN_13, urn:biopax:ModificationFeature:HMGA1_HUMAN_14, urn:biopax:ModificationFeature:HMGA1_HUMAN_15, urn:biopax:ModificationFeature:HMGA1_HUMAN_16, urn:biopax:ModificationFeature:HMGA1_HUMAN_17, urn:biopax:ModificationFeature:HMGA1_HUMAN_18, urn:biopax:ModificationFeature:HMGA1_HUMAN_2, urn:biopax:ModificationFeature:HMGA1_HUMAN_3, urn:biopax:ModificationFeature:HMGA1_HUMAN_4, urn:biopax:ModificationFeature:HMGA1_HUMAN_5, urn:biopax:ModificationFeature:HMGA1_HUMAN_6, urn:biopax:ModificationFeature:HMGA1_HUMAN_7, urn:biopax:ModificationFeature:HMGA1_HUMAN_8, urn:biopax:ModificationFeature:HMGA1_HUMAN_9

MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ