Linked Life Data

P13501

Source:http://identifiers.org/uniprot/P13501

Statements in which the resource exists as a subject.
PredicateObject
rdf:type
biopax3:comment
FUNCTION: Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T- cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils. SUBCELLULAR LOCATION: Secreted. TISSUE SPECIFICITY: T-cell and macrophage specific. INDUCTION: By mitogens. PTM: N-terminal processed form RANTES(3-68) is produced by proteolytic cleavage, probably by DPP4, after secretion from peripheral blood leukocytes and cultured sarcoma cells. PTM: The identity of the O-linked saccharides at Ser-27 and Ser-28 are not reported in PubMed:1380064. They are assigned by similarity. MASS SPECTROMETRY: Mass=7515; Mass_error=1; Method=SELDI; Range=27-91; Source=PubMed:15923218; MASS SPECTROMETRY: Mass=7862.8; Mass_error=1.1; Method=Electrospray; Range=24-91; Source=PubMed:1380064; MASS SPECTROMETRY: Mass=8355; Mass_error=10; Method=Electrospray; Range=24-91; Note=O-glycosylated; Source=PubMed:1380064; POLYMORPHISM: The variant Phe-24 is an antagonist of the chemokine receptors CCR1 and CCR3. SIMILARITY: Belongs to the intercrine beta (chemokine CC) family. WEB RESOURCE: Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/ccl5/"; WEB RESOURCE: Name=Wikipedia; Note=RANTES entry; URL="http://en.wikipedia.org/wiki/RANTES"; GENE SYNONYMS:CCL5 D17S136E SCYA5. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 91 AA; 9990 MW; FB0BFAF9A87C620F CRC64;
biopax3:xref
biopax3:displayName
CCL5_HUMAN
biopax3:name
CCL5, EoCP, Eosinophil chemotactic cytokine, RANTES(3-68), RANTES(4-68), SIS-delta, Small-inducible cytokine A5, T cell-specific protein P228, T-cell-specific protein RANTES, TCP228
biopax3:organism
biopax3:sequence
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
biopax3:standardName
C-C motif chemokine 5