Statements in which the resource exists as a subject.
PredicateObject
rdf:type
biopax3:comment
FUNCTION: Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. SUBUNIT: In general heterodimer of an alpha and a beta chain linked by two disulfide bonds. SUBCELLULAR LOCATION: Isoform 1: Cell membrane; Single-pass type I membrane protein (Probable). SUBCELLULAR LOCATION: Isoform 2: Cell membrane; Single-pass type I membrane protein (Probable). SUBCELLULAR LOCATION: Isoform 3: Secreted (Probable). SUBCELLULAR LOCATION: Isoform 4: Cell membrane; Single-pass type I membrane protein (Probable). SUBCELLULAR LOCATION: Isoform 5: Cell membrane; Single-pass type I membrane protein (Probable). SUBCELLULAR LOCATION: Isoform 6: Secreted (Probable). SUBCELLULAR LOCATION: Isoform 7: Secreted (Probable). SUBCELLULAR LOCATION: Isoform 8: Secreted (Probable). ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=8; Name=1; Synonyms=M-1, Mbeta1; IsoId=P10966-1; Sequence=Displayed; Name=2; Synonyms=M-3, Mbeta2; IsoId=P10966-2; Sequence=VSP_002490; Name=3; Synonyms=S-1, Sbeta3; IsoId=P10966-3; Sequence=VSP_002492, VSP_002493; Name=4; Synonyms=M-2; IsoId=P10966-4; Sequence=VSP_002491; Name=5; Synonyms=Mbeta3; IsoId=P10966-6; Sequence=VSP_002493; Note=Ref.6 (AAI00915) sequence is in conflict in position: 213:I->V; Name=6; Synonyms=Sbeta1; IsoId=P10966-7; Sequence=VSP_002492; Name=7; Synonyms=Sbeta4; IsoId=P10966-8; Sequence=VSP_039654; Name=8; Synonyms=Sbeta5; IsoId=P10966-9; Sequence=VSP_039655; TISSUE SPECIFICITY: Isoform 1, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8 are expressed in both thymus and peripheral CD8+ T-cells. Expression of isoform 1 is higher in thymus CD8+ T-cells than in peripheral CD8+ T-cells. Expression of isoform 6 is higher in peripheral CD8+ T-cells than in thymus CD8+ T-cells. PTM: Phosphorylated as a consequence of T-cell activation (Potential). SIMILARITY: Contains 1 Ig-like V-type (immunoglobulin-like) domain. SEQUENCE CAUTION: Sequence=AAD13877.1; Type=Erroneous gene model prediction; WEB RESOURCE: Name=Wikipedia; Note=CD8 entry; URL="http://en.wikipedia.org/wiki/CD8"; GENE SYNONYMS:CD8B CD8B1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 210 AA; 23722 MW; 675AD919585F4B80 CRC64;
biopax3:xref
urn:biopax:RelationshipXref:HGNC_HGNC:1707, urn:biopax:RelationshipXref:NCBI GENE_926, urn:biopax:RelationshipXref:REFSEQ_NP_001171571, urn:biopax:RelationshipXref:REFSEQ_NP_004922, urn:biopax:RelationshipXref:REFSEQ_NP_742099, urn:biopax:RelationshipXref:REFSEQ_NP_742100, urn:biopax:RelationshipXref:REFSEQ_NP_757362, urn:biopax:UnificationXref:UNIPROT_P10966, urn:biopax:UnificationXref:UNIPROT_P14860, urn:biopax:UnificationXref:UNIPROT_P14861, urn:biopax:UnificationXref:UNIPROT_Q15980, urn:biopax:UnificationXref:UNIPROT_Q496E0, urn:biopax:UnificationXref:UNIPROT_Q496E1, urn:biopax:UnificationXref:UNIPROT_Q9UDB4, urn:biopax:UnificationXref:UNIPROT_Q9UDB5, urn:biopax:UnificationXref:UNIPROT_Q9UDB6, urn:biopax:UnificationXref:UNIPROT_Q9UDB7, urn:biopax:UnificationXref:UNIPROT_Q9UDB8, urn:biopax:UnificationXref:UNIPROT_Q9UDB9, urn:biopax:UnificationXref:UNIPROT_Q9UDC0, urn:biopax:UnificationXref:UNIPROT_Q9UQ55
biopax3:displayName
CD8B_HUMAN
biopax3:name
CD8B, CD8b
biopax3:entityFeature
biopax3:organism
biopax3:sequence
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQFYK
biopax3:standardName
T-cell surface glycoprotein CD8 beta chain