| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. FUNCTION: This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes. SUBUNIT: Monomer. SUBCELLULAR LOCATION: Secreted. TISSUE SPECIFICITY: Activated T-cells, mast cells, natural killer cells. SIMILARITY: Belongs to the IL-3 family. WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/IL3ID60.html"; WEB RESOURCE: Name=SeattleSNPs; URL="http://pga.gs.washington.edu/data/il3/"; GENE SYNONYMS:IL3. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 152 AA; 17233 MW; BB46F23FAC1259A4 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
IL3_HUMAN
|
| biopax3:name |
Hematopoietic growth factor,
IL-3,
IL3,
MCGF,
Mast cell growth factor,
Multipotential colony-stimulating factor,
P-cell-stimulating factor
|
| biopax3:organism | |
| biopax3:sequence |
MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
|
| biopax3:standardName |
Interleukin-3
|