| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. SUBUNIT: Clathrin coats are formed from molecules containing 3 heavy chains and 3 light chains. Interacts with CALY; the interaction stimulates clathrin self-assembly and clathrin- mediated endocytosis (By similarity). SUBCELLULAR LOCATION: Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Membrane, coated pit; Peripheral membrane protein; Cytoplasmic side. Note=Cytoplasmic face of coated pits and vesicles. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=Brain; IsoId=P08081-1; Sequence=Displayed; Name=Non-brain; IsoId=P08081-2; Sequence=VSP_001096; SIMILARITY: Belongs to the clathrin light chain family. GENE SYNONYMS:Clta. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 248 AA; 26981 MW; C939E85B0FD2E124 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
CLCA_RAT
|
| biopax3:name |
Clta,
Lca
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQAHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISEVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAVKELEEWYARQDEQLQKTKASNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
|
| biopax3:standardName |
Clathrin light chain A
|