Predicate | Object |
---|---|
rdf:type | |
biopax3:comment |
FUNCTION: Involved in the presentation of foreign antigens to the immune system. SUBUNIT: Heterodimer of an alpha chain and a beta chain (beta-2- microglobulin). SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane protein. SIMILARITY: Belongs to the MHC class I family. SIMILARITY: Contains 1 Ig-like C1-type (immunoglobulin-like) domain. GENE SYNONYMS:H2-T23. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 357 AA; 40875 MW; 62139862B099D411 CRC64;
|
biopax3:xref | |
biopax3:displayName |
HA15_MOUSE
|
biopax3:name |
H2-T23
|
biopax3:entityFeature | |
biopax3:organism | |
biopax3:sequence |
MLLFAHLLQLLVSATVPTQSSPHSLRYFTTAVSRPGLGEPRFIIVGYVDDTQFVRFDSDAENPRMEPRARWIEQEGPEYWERETWKARDMGRNFRVNLRTLLGYYNQSNDESHTLQWMYGCDVGPDGRLLRGYCQEAYDGQDYISLNEDLRSWTANDIASQISKHKSEAVDEAHQQRAYLQGPCVEWLHRYLRLGNETLQRSDPPKAHVTHHPRSEDEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWAAVVVPLGKEQYYTCHVYHEGLPEPLTLRWEPPPSTVSNMVIIAVLVVLGAVIILGAVVAFVMKRRRHIGVKGCYAHVLGSKSFQTSDWPQKA
|
biopax3:standardName |
H-2 class I histocompatibility antigen, D-37 alpha chain
|