Predicate | Object |
---|---|
rdf:type | |
biopax3:comment |
FUNCTION: C/EBP is a DNA-binding protein that recognizes two different motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. SUBUNIT: Interacts with UBN1. Interacts with PRDM16 (By similarity). Binds DNA as a dimer and can form stable heterodimers with C/EBP beta and gamma. Interacts with ZNF638; this interaction increases transcriptional activation (By similarity). SUBCELLULAR LOCATION: Nucleus. SIMILARITY: Belongs to the bZIP family. C/EBP subfamily. SIMILARITY: Contains 1 bZIP domain. GENE SYNONYMS:Cebpa. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 358 AA; 37371 MW; 4DA8F112F6EA95D0 CRC64;
|
biopax3:xref | |
biopax3:displayName |
CEBPA_RAT
|
biopax3:name |
C/EBP alpha,
Cebpa
|
biopax3:entityFeature | |
biopax3:organism | |
biopax3:sequence |
MESADFYEAEPRPPMSSHLQSPPHAPSNAAFGFPRGAGPAPPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAPAGPGGAVMSAGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPAMGAAGLPGPGGSLKGLAGPHPDLRTGGGGGGGAGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
|
biopax3:standardName |
CCAAT/enhancer-binding protein alpha
|