| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. SUBCELLULAR LOCATION: Secreted. INDUCTION: By IFNG/IFN-gamma. A diverse population of cell types rapidly increases transcription of mRNA encoding this protein. This suggests that gamma-induced protein may be a key mediator of the IFNG/IFN-gamma response. PTM: CXCL10(1-73) is produced by proteolytic cleavage after secretion from keratinocytes. MASS SPECTROMETRY: Mass=8641.8; Method=Electrospray; Range=22-98; Source=PubMed:11559369; SIMILARITY: Belongs to the intercrine alpha (chemokine CxC) family. WEB RESOURCE: Name=Wikipedia; Note=CXCL10 entry; URL="http://en.wikipedia.org/wiki/CXCL10"; GENE SYNONYMS:CXCL10 INP10 SCYB10. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 98 AA; 10881 MW; 44AE51967C58DDFF CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
CXL10_HUMAN
|
| biopax3:name |
10 kDa interferon gamma-induced protein,
CXCL10,
CXCL10(1-73),
Gamma-IP10,
IP-10,
Small-inducible cytokine B10
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
|
| biopax3:standardName |
C-X-C motif chemokine 10
|