| http://identifiers.org/unip... | rdf:type | biopax3:ProteinReference | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | MISCELLANEOUS: The mature chain has 12 additional residues at its amino end, due to a tandem duplication of 36 nucleotides after the codon for residue 36. Residue 42 corresponds to the N-terminal residue of typical kappa chains. GENE SYNONYMS:Igk-V19-17. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License. | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | SEQUENCE 149 AA; 16434 MW; B0480C87B682AC3E CRC64; | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:displayName | KV5A1_MOUSE | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Igk-V19-17 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Ig kappa chain V-V region MPC11 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:organism | http://identifiers.org/taxo... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:sequence | MHHTSMGIKMESQIQVFVFVFLWLSGVDGDIVMTQFAGVDGDIVMTQSHKFMSTSVGDRVSITCKASQDVSTTVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSTPPTFGGGTKLEIKR | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:standardName | Ig kappa chain V19-17 | lld:biopax3 |
| http://www.reactome.org/bio... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
