| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
MISCELLANEOUS: The mature chain has 12 additional residues at its amino end, due to a tandem duplication of 36 nucleotides after the codon for residue 36. Residue 42 corresponds to the N-terminal residue of typical kappa chains. GENE SYNONYMS:Igk-V19-17. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 149 AA; 16434 MW; B0480C87B682AC3E CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
KV5A1_MOUSE
|
| biopax3:name |
Ig kappa chain V-V region MPC11,
Igk-V19-17
|
| biopax3:organism | |
| biopax3:sequence |
MHHTSMGIKMESQIQVFVFVFLWLSGVDGDIVMTQFAGVDGDIVMTQSHKFMSTSVGDRVSITCKASQDVSTTVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSTPPTFGGGTKLEIKR
|
| biopax3:standardName |
Ig kappa chain V19-17
|