Predicate | Object |
---|---|
rdf:type | |
biopax3:comment |
FUNCTION: Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA (By similarity). SUBUNIT: Homodimer; antiparallel disulfide-linked dimer. Heterodimer with PDGFA; antiparallel disulfide-linked dimer. The PDGFB homodimer interacts with PDGFRA and PDGFRB homodimers, and with heterodimers formed by PDGFRA and PDGFRB. The heterodimer composed of PDGFA and PDGFB interacts with PDGFRB homodimers, and with heterodimers formed by PDGFRA and PDGFRB. Interacts with XLKD1 (By similarity). SUBCELLULAR LOCATION: Secreted. Note=Released by platelets upon wounding. TISSUE SPECIFICITY: Expressed at high levels in the heart, brain (sustantia nigra), placenta and fetal kidney. Expressed at moderate levels in the brain (hippocampus), skeletal muscle, kidney and lung. DISEASE: Note=A chromosomal aberration involving PDGFB is found in dermatofibrosarcoma protuberans. Translocation t(17;22)(q22;q13) with PDGFB. PHARMACEUTICAL: Available under the name Regranex (Ortho-McNeil). Used to promote healing in diabetic neuropathic foot ulcers. SIMILARITY: Belongs to the PDGF/VEGF growth factor family. WEB RESOURCE: Name=R&D Systems' cytokine source book: PDGF; URL="http://www.rndsystems.com/molecule_detail.aspx?m=1967"; WEB RESOURCE: Name=Regranex; Note=Clinical information on Regranex; URL="http://www.regranex.com/"; WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/PDGFBID155.html"; GENE SYNONYMS:PDGFB PDGF2 SIS. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 241 AA; 27283 MW; 9F9A3474CE203C0B CRC64;
|
biopax3:xref |
urn:biopax:RelationshipXref:HGNC_HGNC:8800,
urn:biopax:RelationshipXref:NCBI GENE_5155,
urn:biopax:RelationshipXref:REFSEQ_NP_002599,
urn:biopax:RelationshipXref:REFSEQ_NP_148937,
urn:biopax:UnificationXref:UNIPROT_P01127,
urn:biopax:UnificationXref:UNIPROT_P78431,
urn:biopax:UnificationXref:UNIPROT_Q6FHE7,
urn:biopax:UnificationXref:UNIPROT_Q9UF23
|
biopax3:displayName |
PDGFB_HUMAN
|
biopax3:name |
Becaplermin,
PDGF subunit B,
PDGF-2,
PDGFB,
Platelet-derived growth factor B chain,
Platelet-derived growth factor beta polypeptide,
Proto-oncogene c-Sis
|
biopax3:organism | |
biopax3:sequence |
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA
|
biopax3:standardName |
Platelet-derived growth factor subunit B
|