| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Can insert into membranes and form chloride ion channels. May participate in cellular growth control. SUBUNIT: Associated with the C-terminal of ERK7. SUBCELLULAR LOCATION: Nucleus. Membrane; Single-pass membrane protein. Cytoplasm. Note=Predominantly nuclear. Some protein was found in the cytoplasm. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain (By similarity). TISSUE SPECIFICITY: Detected in placenta (at protein level). Widely expressed. High expression is found in placenta followed by lung and heart. Low expression in skeletal muscle, kidney and pancreas. DOMAIN: Members of this family may change from a globular, soluble state to a state where the N-terminal domain is inserted into the membrane and functions as chloride channel. A conformation change of the N-terminal domain is thought to expose hydrophobic surfaces that trigger membrane insertion (By similarity). SIMILARITY: Belongs to the chloride channel CLIC family. SIMILARITY: Contains 1 GST C-terminal domain. SIMILARITY: Contains 1 GST N-terminal domain. SEQUENCE CAUTION: Sequence=AAD16450.1; Type=Frameshift; Positions=28; GENE SYNONYMS:CLIC3. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 236 AA; 26648 MW; CA20E66195950886 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
CLIC3_HUMAN
|
| biopax3:name |
CLIC3
|
| biopax3:organism | |
| biopax3:sequence |
MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
|
| biopax3:standardName |
Chloride intracellular channel protein 3
|