| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Binds specifically to the 3'-terminal U-tract of U6 snRNA. SUBUNIT: LSm subunits form a heteromer with a doughnut shape. SUBCELLULAR LOCATION: Nucleus (Potential). SIMILARITY: Belongs to the snRNP Sm proteins family. GENE SYNONYMS:NAA38 LSM8. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 96 AA; 10403 MW; 15D26E6B75AA2EE1 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
NAA38_HUMAN
|
| biopax3:name |
NAA38,
U6 snRNA-associated Sm-like protein LSm8
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH
|
| biopax3:standardName |
N-alpha-acetyltransferase 38, NatC auxiliary subunit
|