| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Involved in multiple membrane trafficking steps. SUBUNIT: Binds tightly to multiple syntaxins. SUBCELLULAR LOCATION: Cytoplasm. Membrane; Peripheral membrane protein. Cell junction, synapse, synaptosome. Note=Appears to be mostly membrane-bound, probably via interaction with syntaxins, but a significant portion is cytoplasmic. TISSUE SPECIFICITY: Found in brain, heart, kidney, liver, lung, placenta, skeletal muscle, spleen and pancreas. DISEASE: Defects in SNAP29 are the cause of CEDNIK syndrome (CEDNIK) [MIM:609528]. CEDNIK is a neurocutaneous syndrome characterized by cerebral dysgenesis, neuropathy, ichthyosis and palmoplantar keratoderma. SIMILARITY: Belongs to the SNAP-25 family. SIMILARITY: Contains 1 t-SNARE coiled-coil homology domain. GENE SYNONYMS:SNAP29. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 258 AA; 28970 MW; 7E1CDBA22D6F5A3C CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
SNP29_HUMAN
|
| biopax3:name |
SNAP-29,
SNAP29,
Soluble 29 kDa NSF attachment protein,
Vesicle-membrane fusion protein SNAP-29
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL
|
| biopax3:standardName |
Synaptosomal-associated protein 29
|