Statements in which the resource exists as a subject.
PredicateObject
rdf:type
biopax3:comment
FUNCTION: 3'-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs and is also used to silence certain maternal mRNAs translationally during oocyte maturation and early embryonic development. Interacts with both the 3'-end poly(A) tail and the 5'-end cap structure during degradation, the interaction with the cap structure being required for an efficient degradation of poly(A) tails. Involved in nonsense-mediated mRNA decay, a critical process of selective degradation of mRNAs that contain premature stop codons. Also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possibly via its interaction with KHSRP. Probably mediates the removal of poly(A) tails of AREs mRNAs, which constitutes the first step of destabilization. CATALYTIC ACTIVITY: Exonucleolytic cleavage of poly(A) to 5'-AMP. COFACTOR: Divalent metal cations. Mg(2+) is the most probable. SUBUNIT: Homodimer. Interacts with KHSRP and CELF1/CUGBP1. Found in a mRNA decay complex with RENT1, RENT2 and RENT3B. SUBCELLULAR LOCATION: Nucleus. Cytoplasm. Nucleus, nucleolus. Note=Some nuclear fraction is nucleolar. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=O95453-1; Sequence=Displayed; Name=2; IsoId=O95453-2; Sequence=VSP_042846; Note=No experimental confirmation available. Non canonical splice junctions; Name=3; IsoId=O95453-3; Sequence=VSP_042847; TISSUE SPECIFICITY: Ubiquitous. PTM: Phosphorylation by MAPKAPK2, preventing GADD45A mRNA degradation after genotoxic stress. SIMILARITY: Belongs to the CAF1 family. SIMILARITY: Contains 1 R3H domain. GENE SYNONYMS:PARN DAN. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 639 AA; 73451 MW; 6994BE39384DF7AC CRC64;
biopax3:xref
biopax3:displayName
PARN_HUMAN
biopax3:name
3.1.13.4, Deadenylating nuclease, Deadenylation nuclease, PARN, Polyadenylate-specific ribonuclease
biopax3:entityFeature
biopax3:organism
biopax3:sequence
MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW
biopax3:standardName
Poly(A)-specific ribonuclease PARN