| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Functions as a component of the DNA-binding general transcription factor complex TFIID. Binding of TFIID to a promoter (with or without TATA element) is the initial step in pre- initiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification, facilitation of DNA opening and initiation of transcription (By similarity). SUBUNIT: TFIID is composed of TATA binding protein (TBP) and a number of TBP-associated factors (TAFs) (By similarity). SUBCELLULAR LOCATION: Nucleus (By similarity). SIMILARITY: Belongs to the TAF8 family. GENE SYNONYMS:taf8. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 222 AA; 25004 MW; A77F7594169200C3 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
TAF8_SCHPO
|
| biopax3:name |
TBP-associated factor 8,
taf8
|
| biopax3:organism | |
| biopax3:sequence |
MEAVIANILQQLGFDSMTKAAEASFVEAVDKYLRNSFRELALHTQLSKHTIPTTKDVALWLNLLNIPMSSLQTELEKYLKPLPPAINDELDRLANESQDIPSKFKSSLDSKMVSQLLGSLAVSQNRPAYVVNHLPPFPASHTYMATPVYPVRPTSPKQIRELATQESRLAEHALRKILNVNQPRSADSPRHASFEKACSELNLDVSSFHLVNWESQKWSSQR
|
| biopax3:standardName |
Transcription initiation factor TFIID subunit 8
|