| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Interacts with SLP-76 to regulate NF-AT activation. Binds to tyrosine-phosphorylated shc. SUBUNIT: Interacts with phosphorylated LAT and LAX1 upon TCR activation. Interacts with SHB. Interacts with PTPN23 (By similarity). Interacts with phosphorylated LIME1 upon TCR activation. SUBCELLULAR LOCATION: Nucleus (By similarity). Cytoplasm (By similarity). Endosome (By similarity). SIMILARITY: Belongs to the GRB2/sem-5/DRK family. SIMILARITY: Contains 1 SH2 domain. SIMILARITY: Contains 2 SH3 domains. GENE SYNONYMS:Grap2 Gads Grb2l Grid Mona. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 322 AA; 36810 MW; 736311D0640CD3D0 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
GRAP2_MOUSE
|
| biopax3:name |
Adapter protein GRID,
GADS protein,
GRB-2-like protein,
GRB-2-related monocytic adapter protein,
GRB2L,
GRBLG,
Grap2,
Growth factor receptor-binding protein,
Hematopoietic cell-associated adaptor protein GrpL,
MONA,
Monocytic adapter
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MEATAKFDFMASGEDELSFRTGDILKILSNQEEWLKAELGSQEGYVPKNFIDIEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRDGTQDQGHRGNSLDRRSQGGPHPSGTVGEEIRPSVNRKLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQRYLQHFHQDRRGGSLDINDGHCGLGSEVNATLMHRRHTDPVQLQAAGRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR
|
| biopax3:standardName |
GRB2-related adaptor protein 2
|