Statements in which the resource exists as a subject.
PredicateObject
rdf:type
biopax3:comment
FUNCTION: Required for normal cytokinesis during mitosis. Plays a role in the regulation of cell proliferation. May be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Increases AURKB activity. Inhibits apoptosis induced by TGFB1 (By similarity). Overexpression induces swelling of mitochondria and reduces mitochondrial membrane potential (By similarity). SUBUNIT: Interacts with AURKA, AURKB, BIRC5 and INCENP. May be a component of the CPC at least composed of BIRC5/survivin, CDCA8/borealin, INCENP and AURKB/Aurora-B. SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane protein (Potential). Mitochondrion (By similarity). Cytoplasm. Cytoplasm, cytoskeleton, centrosome. Cytoplasm, cytoskeleton, spindle. Note=Detected at the centrosome and along spindle fibers during prophase and metaphase. Detected at the midbody during telophase. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O76095-1; Sequence=Displayed; Name=2; IsoId=O76095-2; Sequence=VSP_041400; TISSUE SPECIFICITY: Ubiquitous. Expressed in all normal human tissues studied but overexpressed or underexpressed in many of their malignant counterparts. INDUCTION: Protein levels increase during the S phase of the cell cycle, are highest during G2 and mitosis, and decrease to low levels at G1. Levels are lowest at the transition from G1 to S phase. SIMILARITY: Belongs to the JTB family. GENE SYNONYMS:JTB. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 146 AA; 16358 MW; CA7080543591C319 CRC64;
biopax3:xref
biopax3:displayName
JTB_HUMAN
biopax3:name
JTB, Jumping translocation breakpoint protein, PAR protein, Prostate androgen-regulated protein
biopax3:organism
biopax3:sequence
MLAGAGRPGLPQGRHLCWLLCAFTLKLCQAEAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVIIRQRQLDRKALEKVRKQIESI
biopax3:standardName
Protein JTB