| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Required for normal cytokinesis during mitosis. Plays a role in the regulation of cell proliferation. May be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Increases AURKB activity. Inhibits apoptosis induced by TGFB1 (By similarity). Overexpression induces swelling of mitochondria and reduces mitochondrial membrane potential (By similarity). SUBUNIT: Interacts with AURKA, AURKB, BIRC5 and INCENP. May be a component of the CPC at least composed of BIRC5/survivin, CDCA8/borealin, INCENP and AURKB/Aurora-B. SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane protein (Potential). Mitochondrion (By similarity). Cytoplasm. Cytoplasm, cytoskeleton, centrosome. Cytoplasm, cytoskeleton, spindle. Note=Detected at the centrosome and along spindle fibers during prophase and metaphase. Detected at the midbody during telophase. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O76095-1; Sequence=Displayed; Name=2; IsoId=O76095-2; Sequence=VSP_041400; TISSUE SPECIFICITY: Ubiquitous. Expressed in all normal human tissues studied but overexpressed or underexpressed in many of their malignant counterparts. INDUCTION: Protein levels increase during the S phase of the cell cycle, are highest during G2 and mitosis, and decrease to low levels at G1. Levels are lowest at the transition from G1 to S phase. SIMILARITY: Belongs to the JTB family. GENE SYNONYMS:JTB. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 146 AA; 16358 MW; CA7080543591C319 CRC64;
|
| biopax3:xref |
urn:biopax:RelationshipXref:HGNC_HGNC:6201,
urn:biopax:RelationshipXref:NCBI GENE_10899,
urn:biopax:RelationshipXref:REFSEQ_NP_006685,
urn:biopax:UnificationXref:UNIPROT_O76095,
urn:biopax:UnificationXref:UNIPROT_O95442,
urn:biopax:UnificationXref:UNIPROT_Q6IB19,
urn:biopax:UnificationXref:UNIPROT_Q9P0Q4
|
| biopax3:displayName |
JTB_HUMAN
|
| biopax3:name |
JTB,
Jumping translocation breakpoint protein,
PAR protein,
Prostate androgen-regulated protein
|
| biopax3:organism | |
| biopax3:sequence |
MLAGAGRPGLPQGRHLCWLLCAFTLKLCQAEAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVIIRQRQLDRKALEKVRKQIESI
|
| biopax3:standardName |
Protein JTB
|