Predicate | Object |
---|---|
rdf:type | |
biopax3:comment |
FUNCTION: May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein. SUBUNIT: Can bind to LGI1 and LGI4 (By similarity). Ligand for integrin alpha-V/beta-3. SUBCELLULAR LOCATION: Cell membrane; Single-pass type I membrane protein (Potential). SUBCELLULAR LOCATION: Isoform Gamma: Secreted. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=3; Name=Alpha; IsoId=O75077-1; Sequence=Displayed; Name=Beta; IsoId=O75077-2; Sequence=VSP_012046; Name=Gamma; IsoId=O75077-3; Sequence=VSP_012045; TISSUE SPECIFICITY: Highly expressed in the brain and weakly expressed in the heart. In the brain, expressed prominently in the amygdala, caudate nucleus, hypothalamus, thalamus, cerebral cortex and occipital pole. DEVELOPMENTAL STAGE: Highly expressed in the fetal brain. DOMAIN: A conserved motif AVN[ED]CD within the disintegrin-like domain could be involved in the binding to the integrin receptor. SIMILARITY: Contains 1 disintegrin domain. SIMILARITY: Contains 1 EGF-like domain. SIMILARITY: Contains 1 peptidase M12B domain. WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/ADAM23ID44041ch2q33.html"; GENE SYNONYMS:ADAM23 MDC3. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 832 AA; 91926 MW; 7841A9670E1C24EF CRC64;
|
biopax3:xref | |
biopax3:displayName |
ADA23_HUMAN
|
biopax3:name |
ADAM 23,
ADAM23,
MDC-3,
Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3
|
biopax3:entityFeature | |
biopax3:organism | |
biopax3:sequence |
MKPPGSSSRQPPLAGCSLAGASCGPQRGPAGSVPASAPARTPPCRLLLVLLLLPPLAASSRPRAWGAAAPSAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILDLILNNGLLSSDYVEIHYENGKPQYSKGGEHCYYHGSIRGVKDSKVALSTCNGLHGMFEDDTFVYMIEPLELVHDEKSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQWLKRRKRAVNPSRGIFEEMKYLELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYECRDAVNECDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCYNGECKTRDNQCQYIWGTKAAGSDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCGPSMMCLDRKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSIRDPVRNLHPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI
|
biopax3:standardName |
Disintegrin and metalloproteinase domain-containing protein 23
|